Feed: blogging: Blogging For Dummies (For Dummies (Computer/Tech)) - AggScore: 18.1

blogging: Blogging For Dummies (For Dummies (Computer/Tech))

---

pa targetblank hrefhttpmarketingaffiliatewealth.comgo0471770841wkla relnofollow external titleBlogging For Dummies For Dummies ComputerTechBlogging For Dummies For Dummies ComputerTechapa targetblank hrefhttpmarketingaffiliatewealth.comgo0471770841wkla relnofollow external titleBlogging For Dummies For Dummies ComputerTechimg srchttpecx.imagesamazon.comimagesI51jYm3Ei5NL.jpg altBlogging For Dummies For Dummies ComputerTech titleBlogging For Dummies For Dummies ComputerTech abrList Price 21.99hrbrspan stylefloatlefta targetblank hrefhttpmarketingaffiliatewealth.comgo0471770841wkla relnofollow externalimg srchttpecx.imagesamazon.comimagesI51jYm3Ei5NL.SL160.jpg altBlogging For Dummies For Dummies ComputerTech titleBlogging For Dummies For Dummies ComputerTech abrList Price 21.99brYour Price 5.23 a targetblank hrefhttpmarketingaffiliatewealth.comgo0471770841wkla relnofollow externalimg srchttpmarketingaffiliatewealth.comwpcontentpluginswpmppimgbuynow.gif altBlogging For Dummies For Dummies ComputerTech titleBlogging For Dummies For Dummies ComputerTech abrspanbrpIf you want to give yourself a Web presence without spending a lot of time or money, a blog is your answer and this is your guide. Blogs Web logs are short, diarylike entries on a Web site that has a chronological, journal format. Fun or informative, but not formal, blogs are easy to set up, maintain, and update. You can share your personal, streamofconsciousness musings or your expertise on any subject ranging from your family vacation to world peace. This guide helps beginners even technophobes get started fast, with the essential info on ul typedisc liThe elements of blogs, such as entries, sidebars, categories, comments, and index pages liThe different types of hosting services, from free to fee and from turn key services that are easytouse to DIY programs liDetails on two popular, free social community hosted Web services that are ideal for casual bloggersMSN Spaces and Yahoo! 360 liThe scoop on Blogger, a popular free hosted service that has some community tools like the social networks, but is basically blogintensive liDIY blogging, covering three of the most powerful and flexible blog programsMovable Type, WordPress, and Radio Userland liHooking into RSS feeds to distribute your blog entries beyond your site liChoosing a newsreader liWays to raise the visibility of your blog and make money from blogging ul p Complete with stepbystep instructions and lots of screen shots, this guide walks you through everything from setting up your blog and posting your first entry to adding photos, audio, and more. It includes the URLs of lots of sample sites to see to give you an idea of blog possibilities. In addition to the essential howto, it fills you in on ul typedisc liThe blogosphere, blog culture and etiquette, snarks, macrologues, and more liMoblogs that let you post entries remotely using your portable computer, PDA, or cell phone liBuying a domain through a registrar such as Network Solutions, Register.com, or Go Daddy liMP3 blogs, vlogs videoblogs, photoblogging, audioblogging, podcasting, and more ul p You know you have something to say, whether its heavy stuff or just your thought for the day. Make your opinions known. Get your photos shown. With iBlogging For Dummiesi, youll soon be blogging with the best of em.pbrYour Price 5.23 a targetblank hrefhttpmarketingaffiliatewealth.comgo0471770841wkla relnofollow externalimg srchttpmarketingaffiliatewealth.comwpcontentpluginswpmppimgbuynow.gif altBlogging For Dummies For Dummies ComputerTech titleBlogging For Dummies For Dummies ComputerTech a

Learn Online Marketing: The Social Media Marketing Book

---

Are you looking to take advantage of social media for your business or organization With easytounderstand introductions to blogging, forums, opinion and review sites, and social networks such as Twitter, Facebook, and LinkedIn, this book will help you choose the best and avoid the worst of the social webs unique marketing opportunities.